Glyasperin F

CAS No. 145382-61-2

Glyasperin F( —— )

Catalog No. M31793 CAS No. 145382-61-2

Glyasperin F has antinociceptive, and anti-inflammatory effects, it could inhibit NO production in RAW 264.7 macrophages to some extent.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 1377 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock

Biological Information

  • Product Name
    Glyasperin F
  • Note
    Research use only, not for human use.
  • Brief Description
    Glyasperin F has antinociceptive, and anti-inflammatory effects, it could inhibit NO production in RAW 264.7 macrophages to some extent.
  • Description
    Glyasperin F has antinociceptive, and anti-inflammatory effects, it could inhibit NO production in RAW 264.7 macrophages to some extent. Glyasperin F displayed cytotoxic effects against the four tested cancer cell lines with IC50values below 85 μM.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    145382-61-2
  • Formula Weight
    354.35
  • Molecular Formula
    C20H18O6
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • RET-IN-1

    RET-IN-1 is a RET kinase inhibitor extracted from patent WO2018071447A1, Compound Example 552.

  • Synaptobrevin-2 (75-...

    Synaptobrevin-2 (75-78) (human, bovine, mouse, rat)